PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010104403.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family G2-like
Protein Properties Length: 468aa    MW: 52771.8 Da    PI: 7.8892
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010104403.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.52.2e-3189142255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     prlrWtp+LH +Fv+ave+LGG+e+AtPk + +lm+vkgL+++hvkSHLQ+YR+
  XP_010104403.1  89 PRLRWTPDLHLAFVHAVERLGGQERATPKLVQQLMDVKGLSIAHVKSHLQMYRS 142
                     8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.86285145IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-2985143IPR009057Homeodomain-like
SuperFamilySSF466899.14E-1487143IPR009057Homeodomain-like
TIGRFAMsTIGR015577.4E-2289144IPR006447Myb domain, plants
PfamPF002494.4E-890141IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MAGRIERYTD HDGNSSDGSD FQAKASSLLN SRKFDLNEEA TGTEEADSSI NNGVLHDEDL  60
KEKNVEEKVL YSGTKSTSSV RPYVRSKMPR LRWTPDLHLA FVHAVERLGG QERATPKLVQ  120
QLMDVKGLSI AHVKSHLQMY RSKKLDESGQ VLSQTNTPTQ REDHIMQMYH SFNNLYKGNF  180
AMECRSHFFP PTLSKHPCDS NANPSRYHPP WSSSPLWSKG FGIDKGDHVI DTVNILQKGI  240
NKRTSSQIFD LRDAIITRTV PPLRPSQFLE EKKWPPRENI IGNHRITSRR TSQLMNFSRG  300
HNNVNAHDHV DMFAQTKANI TSTNYPFQLN TCTDPFLASL SQLEVHGIRA KQCTNSEVKH  360
EAQESLKEKK WLPDLQLSLG HINCDGVTEI NDSQENKAAE TETMLSLSLS TTSSRQQDVE  420
CCSDKRRKET NMSSQNEKWD FHTIKVSCSG SGGATYRPST LGSGDHGN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010104403.10.0Putative Myb family transcription factor
TrEMBLW9RZ550.0W9RZ55_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30123270
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-38G2-like family protein